PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G35890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 777aa    MW: 84336.8 Da    PI: 7.0322
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G35890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.12e-2096151156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r++ +++t+eq++++e+lF+++++p++++r++ +k+lgL+ rqVk+WFqNrR++ k
  OGLUM01G35890.1  96 RKNYHRHTAEQIRIMEALFKESPHPDERQRQQVSKQLGLSARQVKFWFQNRRTQIK 151
                      788999**********************************************9877 PP

2START173.51.3e-543125382206
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                      la +a++elv + +++ep+Wv+ +    +++n+de+++ f ++++         ++ea+r++g+v  ++++lv +++d+  +W+  ++    ka
  OGLUM01G35890.1 312 LATRALDELVGMCSSGEPVWVRGVetgrDILNYDEYVRLFRRDHGgsgdqmagWTVEASRECGLVYLETMQLVHTFMDVD-KWKDLFPtmisKA 404
                      577899************************************999***********************************.99998888888** PP

                      EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
            START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                      +tle is+       g+lqlm+aelq l+p+vp R+ +f+Ry+++l a++w+ivdvS d+ +     ss vR+ + pSg+lie+  ng++k+tw
  OGLUM01G35890.1 405 ATLEMISNReddgrdGVLQLMYAELQTLTPMVPtRELYFARYCKKLAAERWAIVDVSFDESETGVHASSAVRCWKNPSGCLIEEQNNGRCKMTW 498
                      *******99999***********************************************9999998**************************** PP

                      EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      veh+ ++  ++  l+r +  sg+a+ga++wva+lq qce+
  OGLUM01G35890.1 499 VEHTRCRRCTVAPLYRAVTASGVAFGARRWVAALQLQCER 538
                      **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-2079154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-2282147IPR009057Homeodomain-like
CDDcd000866.08E-1793151No hitNo description
PROSITE profilePS5007117.62193153IPR001356Homeobox domain
SMARTSM003893.5E-1795157IPR001356Homeobox domain
PfamPF000468.1E-1896151IPR001356Homeobox domain
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PROSITE profilePS5084839.305302541IPR002913START domain
SuperFamilySSF559611.51E-31303538No hitNo description
CDDcd088755.70E-110306537No hitNo description
SMARTSM002346.4E-46311538IPR002913START domain
PfamPF018524.9E-45312538IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-4374502IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MGTNRPRPRT KDFFAAPALS LTLAGVFGRK NGPAASGGDG VEEGDEEVQA AGEAAVEISS  60
ENAGPGCSQS QSGGGSGEDG GHDDDDGEGS NKKRRRKNYH RHTAEQIRIM EALFKESPHP  120
DERQRQQVSK QLGLSARQVK FWFQNRRTQI KAVQERHENS LLKSELEKLQ DEHRAMRELA  180
KKPSRCLNCG VVATSSDAAA AATAADTREQ RLRLENAKLK AEVCMPPPRS RARPFRCATL  240
QDTDSGELAM LNLFQIERLR GTPGKSAADG VASPPCSASA GAMQTNSRSP PLHDHDGGFL  300
RHDDDKPRIL KLATRALDEL VGMCSSGEPV WVRGVETGRD ILNYDEYVRL FRRDHGGSGD  360
QMAGWTVEAS RECGLVYLET MQLVHTFMDV DKWKDLFPTM ISKAATLEMI SNREDDGRDG  420
VLQLMYAELQ TLTPMVPTRE LYFARYCKKL AAERWAIVDV SFDESETGVH ASSAVRCWKN  480
PSGCLIEEQN NGRCKMTWVE HTRCRRCTVA PLYRAVTASG VAFGARRWVA ALQLQCERMV  540
FAVATNVPTR DSTGVSTLAG RRSVLKLAHR MTSSLCRTTG GSRDMAWRRA PKGGSGGGGD  600
DDIWLTSREN AGDDPGEPQG LIARVNLAKG KDRTNCVTAY AARPEEEEER GGKWVLQDVC  660
TNPCESTIAY AAIDAAALQP VIAGHDSSGV HLLPCGFISV MPDGLESKPA VITASRRGGE  720
ASGAGSLVTV AFQVPASPSA AAATLSPDSV EAVTVLVSST LRNIRKALGC DSFEEEF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19097NKKRRRKN
29196KKRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644459.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLA0A0D9YF960.0A0A0D9YF96_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g55549.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.11e-169HD-ZIP family protein